CSC

 
 
Tehdyt toimenpiteet
EMBOSS: prettyplot
prettyplot

 

Wiki

The master copies of EMBOSS documentation are available at http://emboss.open-bio.org/wiki/Appdocs on the EMBOSS Wiki.

Please help by correcting and extending the Wiki pages.

Function

Draw a sequence alignment with pretty formatting

Description

prettyplot draws a plot of the input sequence alignment. The sequences are rendered in pretty formatting on the specified graphics device. Drawing options control the appearance of the image, such as boxes, colour and shading for highlighting conserved regions.

Usage

Here is a sample session with prettyplot 


% prettyplot -resbreak=10 -boxcol -consensus -plurality=3 
Draw a sequence alignment with pretty formatting
Input (aligned) sequence set: globins.msf
Graph type [x11]: cps

Created prettyplot.ps

Go to the input files for this example
Go to the output files for this example

Example 2 


% prettyplot globins.msf -plurality=3 -docolour 
Draw a sequence alignment with pretty formatting
Graph type [x11]: cps

Created prettyplot.ps

Go to the output files for this example

Command line arguments 

Draw a sequence alignment with pretty formatting
Version: EMBOSS:6.4.0.0

   Standard (Mandatory) qualifiers:
  [-sequences]         seqset     (Aligned) sequence set filename and optional
                                  format, or reference (input USA)
   -graph              graph      [$EMBOSS_GRAPHICS value, or x11] Graph type
                                  (ps, hpgl, hp7470, hp7580, meta, cps, x11,
                                  tek, tekt, none, data, xterm, png, gif, pdf,
                                  svg)

   Additional (Optional) qualifiers:
   -matrixfile         matrix     [EBLOSUM62 for protein, EDNAFULL for DNA]
                                  This is the scoring matrix file used when
                                  comparing sequences. By default it is the
                                  file 'EBLOSUM62' (for proteins) or the file
                                  'EDNAFULL' (for nucleic sequences). These
                                  files are found in the 'data' directory of
                                  the EMBOSS installation.
   -residuesperline    integer    [50] The number of residues to be displayed
                                  on each line (Any integer value)
   -resbreak           integer    [Same as -residuesperline to give no breaks]
                                  Residues before a space (Integer 1 or more)
   -[no]ccolours       boolean    [Y] Colour residues by their consensus
                                  value.
   -cidentity          string     [RED] Colour to display identical residues
                                  (RED) (Any string)
   -csimilarity        string     [GREEN] Colour to display similar residues
                                  (GREEN) (Any string)
   -cother             string     [BLACK] Colour to display other residues
                                  (BLACK) (Any string)
   -docolour           boolean    [N] Colour residues by table oily, amide
                                  etc.
   -shade              string     Set to BPLW for normal shading
                                  (black, pale, light, white)
                                  so for pair = 1.5,1.0,0.5 and shade = BPLW
                                  Residues score Colour
                                  1.5 or over... BLACK (B)
                                  1.0 to 1.5 ... BROWN (P)
                                  0.5 to 1.0 ... WHEAT (L)
                                  under 0.5 .... WHITE (W)
                                  The only four letters allowed are BPLW, in
                                  any order. (Any string up to 4 characters,
                                  matching regular expression
                                  /^([BPLW]{4})?$/)
   -pair               array      [1.5,1.0,0.5] Values to represent identical
                                  similar related
   -identity           integer    [0] Only match those which are identical in
                                  all sequences. (Integer 0 or more)
   -[no]box            boolean    [Y] Display prettyboxes
   -boxcol             boolean    [N] Colour the background in the boxes
   -boxuse             string     [GREY] Colour to be used for background.
                                  (GREY) (Any string)
   -[no]name           boolean    [Y] Display the sequence names
   -maxnamelen         integer    [10] Margin size for the sequence name. (Any
                                  integer value)
   -[no]number         boolean    [Y] Display the residue number
   -[no]listoptions    boolean    [Y] Display the date and options used
   -plurality          float      [Half the total sequence weighting]
                                  Plurality check value (totweight/2) (Any
                                  numeric value)
   -consensus          boolean    [N] Display the consensus
   -[no]collision      boolean    [Y] Allow collisions in calculating
                                  consensus
   -alternative        menu       [0] Values are 0:Normal collision check.
                                  (default)
                                  1:Compares identical scores with the max
                                  score found. So if any other residue matches
                                  the identical score then a collision has
                                  occurred.
                                  2:If another residue has a greater than or
                                  equal to matching score and these do not
                                  match then a collision has occurred.
                                  3:Checks all those not in the current
                                  consensus.If any of these give a top score
                                  for matching or identical scores then a
                                  collision has occured. (Values: 0 (Normal
                                  collision check. (default)); 1 (Compares
                                  identical scores with the max score found.
                                  So if any other residue matches the
                                  identical score then a collision has
                                  occurred.); 2 (If another residue has a
                                  greater than or equal to matching score and
                                  these do not match then a collision has
                                  occurred.); 3 (Checks all those not in the
                                  current consensus.If any of these give a top
                                  score for matching or identical scores then
                                  a collision has occured.))
   -showscore          integer    [-1] Print residue scores (Any integer
                                  value)
   -portrait           boolean    [N] Set page to Portrait

   Advanced (Unprompted) qualifiers: (none)
   Associated qualifiers:

   "-sequences" associated qualifiers
   -sbegin1            integer    Start of each sequence to be used
   -send1              integer    End of each sequence to be used
   -sreverse1          boolean    Reverse (if DNA)
   -sask1              boolean    Ask for begin/end/reverse
   -snucleotide1       boolean    Sequence is nucleotide
   -sprotein1          boolean    Sequence is protein
   -slower1            boolean    Make lower case
   -supper1            boolean    Make upper case
   -sformat1           string     Input sequence format
   -sdbname1           string     Database name
   -sid1               string     Entryname
   -ufo1               string     UFO features
   -fformat1           string     Features format
   -fopenfile1         string     Features file name

   "-graph" associated qualifiers
   -gprompt            boolean    Graph prompting
   -gdesc              string     Graph description
   -gtitle             string     Graph title
   -gsubtitle          string     Graph subtitle
   -gxtitle            string     Graph x axis title
   -gytitle            string     Graph y axis title
   -goutfile           string     Output file for non interactive displays
   -gdirectory         string     Output directory

   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write first file to standard output
   -filter             boolean    Read first file from standard input, write
                                  first file to standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options and exit. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report dying program messages
   -version            boolean    Report version number and exit

Qualifier Type Description Allowed values Default
Standard (Mandatory) qualifiers
[-sequences]
(Parameter 1)		 seqset (Aligned) sequence set filename and optional format, or reference (input USA) Readable set of sequences Required
-graph graph Graph type EMBOSS has a list of known devices, including ps, hpgl, hp7470, hp7580, meta, cps, x11, tek, tekt, none, data, xterm, png, gif, pdf, svg EMBOSS_GRAPHICS value, or x11
Additional (Optional) qualifiers
-matrixfile matrix This is the scoring matrix file used when comparing sequences. By default it is the file 'EBLOSUM62' (for proteins) or the file 'EDNAFULL' (for nucleic sequences). These files are found in the 'data' directory of the EMBOSS installation. Comparison matrix file in EMBOSS data path EBLOSUM62 for protein
EDNAFULL for DNA
-residuesperline integer The number of residues to be displayed on each line Any integer value 50
-resbreak integer Residues before a space Integer 1 or more Same as -residuesperline to give no breaks
-[no]ccolours boolean Colour residues by their consensus value. Boolean value Yes/No Yes
-cidentity string Colour to display identical residues (RED) Any string RED
-csimilarity string Colour to display similar residues (GREEN) Any string GREEN
-cother string Colour to display other residues (BLACK) Any string BLACK
-docolour boolean Colour residues by table oily, amide etc. Boolean value Yes/No No
-shade string Set to BPLW for normal shading (black, pale, light, white) so for pair = 1.5,1.0,0.5 and shade = BPLW Residues score Colour 1.5 or over... BLACK (B) 1.0 to 1.5 ... BROWN (P) 0.5 to 1.0 ... WHEAT (L) under 0.5 .... WHITE (W) The only four letters allowed are BPLW, in any order. Any string up to 4 characters, matching regular expression /^([BPLW]{4})?$/  
-pair array Values to represent identical similar related List of floating point numbers 1.5,1.0,0.5
-identity integer Only match those which are identical in all sequences. Integer 0 or more 0
-[no]box boolean Display prettyboxes Boolean value Yes/No Yes
-boxcol boolean Colour the background in the boxes Boolean value Yes/No No
-boxuse string Colour to be used for background. (GREY) Any string GREY
-[no]name boolean Display the sequence names Boolean value Yes/No Yes
-maxnamelen integer Margin size for the sequence name. Any integer value 10
-[no]number boolean Display the residue number Boolean value Yes/No Yes
-[no]listoptions boolean Display the date and options used Boolean value Yes/No Yes
-plurality float Plurality check value (totweight/2) Any numeric value Half the total sequence weighting
-consensus boolean Display the consensus Boolean value Yes/No No
-[no]collision boolean Allow collisions in calculating consensus Boolean value Yes/No Yes
-alternative list Values are 0:Normal collision check. (default) 1:Compares identical scores with the max score found. So if any other residue matches the identical score then a collision has occurred. 2:If another residue has a greater than or equal to matching score and these do not match then a collision has occurred. 3:Checks all those not in the current consensus.If any of these give a top score for matching or identical scores then a collision has occured.
0 (Normal collision check. (default))
1 (Compares identical scores with the max score found. So if any other residue matches the identical score then a collision has occurred.)
2 (If another residue has a greater than or equal to matching score and these do not match then a collision has occurred.)
3 (Checks all those not in the current consensus.If any of these give a top score for matching or identical scores then a collision has occured.)
 0
-showscore integer Print residue scores Any integer value -1
-portrait boolean Set page to Portrait Boolean value Yes/No No
Advanced (Unprompted) qualifiers
(none)
Associated qualifiers
"-sequences" associated seqset qualifiers
-sbegin1
-sbegin_sequences		 integer Start of each sequence to be used Any integer value 0
-send1
-send_sequences		 integer End of each sequence to be used Any integer value 0
-sreverse1
-sreverse_sequences		 boolean Reverse (if DNA) Boolean value Yes/No N
-sask1
-sask_sequences		 boolean Ask for begin/end/reverse Boolean value Yes/No N
-snucleotide1
-snucleotide_sequences		 boolean Sequence is nucleotide Boolean value Yes/No N
-sprotein1
-sprotein_sequences		 boolean Sequence is protein Boolean value Yes/No N
-slower1
-slower_sequences		 boolean Make lower case Boolean value Yes/No N
-supper1
-supper_sequences		 boolean Make upper case Boolean value Yes/No N
-sformat1
-sformat_sequences		 string Input sequence format Any string  
-sdbname1
-sdbname_sequences		 string Database name Any string  
-sid1
-sid_sequences		 string Entryname Any string  
-ufo1
-ufo_sequences		 string UFO features Any string  
-fformat1
-fformat_sequences		 string Features format Any string  
-fopenfile1
-fopenfile_sequences		 string Features file name Any string  
"-graph" associated graph qualifiers
-gprompt boolean Graph prompting Boolean value Yes/No N
-gdesc string Graph description Any string Pretty plot
-gtitle string Graph title Any string  
-gsubtitle string Graph subtitle Any string  
-gxtitle string Graph x axis title Any string  
-gytitle string Graph y axis title Any string  
-goutfile string Output file for non interactive displays Any string  
-gdirectory string Output directory Any string  
General qualifiers
-auto boolean Turn off prompts Boolean value Yes/No N
-stdout boolean Write first file to standard output Boolean value Yes/No N
-filter boolean Read first file from standard input, write first file to standard output Boolean value Yes/No N
-options boolean Prompt for standard and additional values Boolean value Yes/No N
-debug boolean Write debug output to program.dbg Boolean value Yes/No N
-verbose boolean Report some/full command line options Boolean value Yes/No Y
-help boolean Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose Boolean value Yes/No N
-warning boolean Report warnings Boolean value Yes/No Y
-error boolean Report errors Boolean value Yes/No Y
-fatal boolean Report fatal errors Boolean value Yes/No Y
-die boolean Report dying program messages Boolean value Yes/No Y
-version boolean Report version number and exit Boolean value Yes/No N

Input file format

prettyplot reads aligned protein sequences.

The input is a standard EMBOSS sequence query (also known as a 'USA').

Major sequence database sources defined as standard in EMBOSS installations include srs:embl, srs:uniprot and ensembl

Data can also be read from sequence output in any supported format written by an EMBOSS or third-party application.

The input format can be specified by using the command-line qualifier -sformat xxx, where 'xxx' is replaced by the name of the required format. The available format names are: gff (gff3), gff2, embl (em), genbank (gb, refseq), ddbj, refseqp, pir (nbrf), swissprot (swiss, sw), dasgff and debug.

See: http://emboss.sf.net/docs/themes/SequenceFormats.html for further information on sequence formats.

Input files for usage example

File: globins.msf

!!AA_MULTIPLE_ALIGNMENT 1.0

  ../data/globins.msf MSF:  164 Type: P 25/06/01 CompCheck: 4278 ..

  Name: HBB_HUMAN Len: 164  Check: 6914 Weight: 0.61
  Name: HBB_HORSE Len: 164  Check: 6007 Weight: 0.65
  Name: HBA_HUMAN Len: 164  Check: 3921 Weight: 0.65
  Name: HBA_HORSE Len: 164  Check: 4770 Weight: 0.83
  Name: MYG_PHYCA Len: 164  Check: 7930 Weight: 1.00
  Name: GLB5_PETMA Len: 164  Check: 1857 Weight: 0.91
  Name: LGB2_LUPLU Len: 164  Check: 2879 Weight: 0.43

//

           1                                               50
HBB_HUMAN  ~~~~~~~~VHLTPEEKSAVTALWGKVN.VDEVGGEALGR.LLVVYPWTQR
HBB_HORSE  ~~~~~~~~VQLSGEEKAAVLALWDKVN.EEEVGGEALGR.LLVVYPWTQR
HBA_HUMAN  ~~~~~~~~~~~~~~VLSPADKTNVKAA.WGKVGAHAGEYGAEALERMFLS
HBA_HORSE  ~~~~~~~~~~~~~~VLSAADKTNVKAA.WSKVGGHAGEYGAEALERMFLG
MYG_PHYCA  ~~~~~~~VLSEGEWQLVLHVWAKVEAD.VAGHGQDILIR.LFKSHPETLE
GLB5_PETMA PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQE
LGB2_LUPLU ~~~~~~~~GALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKD

           51                                             100
HBB_HUMAN  FFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSE
HBB_HORSE  FFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSE
HBA_HUMAN  FPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSD
HBA_HORSE  FPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSD
MYG_PHYCA  KFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQ
GLB5_PETMA FFPKFKGLTTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRD
LGB2_LUPLU LFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKN

           101                                            150
HBB_HUMAN  LHCDKLH..VDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVA
HBB_HORSE  LHCDKLH..VDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVA
HBA_HUMAN  LHAHKLR..VDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVS
HBA_HORSE  LHAHKLR..VDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVS
MYG_PHYCA  SHATKHK..IPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFR
GLB5_PETMA LSGKHAK..SFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSA
LGB2_LUPLU LGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELA

           151        164
HBB_HUMAN  NALAHKYH~~~~~~
HBB_HORSE  NALAHKYH~~~~~~
HBA_HUMAN  TVLTSKYR~~~~~~
HBA_HORSE  TVLTSKYR~~~~~~
MYG_PHYCA  KDIAAKYKELGYQG
GLB5_PETMA Y~~~~~~~~~~~~~
LGB2_LUPLU IVIKKEMNDAA~~~

Output file format

The output is to the specified graphics device.

The results can be output in one of several formats by using the command-line qualifier -graph xxx, where 'xxx' is replaced by the name of the required device. Support depends on the availability of third-party software packages.

The device names that output to a file are: ps (postscript), cps (colourps), png, gif, pdf, svg, hpgl, hp7470, hp7580, das, data.

The other available device names are: meta, x11 (xwindows), tek (tek4107t), tekt (tektronix), xterm, text.

Output can be turned off by specifying none (null).

See: http://emboss.sf.net/docs/themes/GraphicsDevices.html for further information on supported devices.

Output files for usage example

Graphics File: prettyplot.ps

[prettyplot results]

Output files for usage example 2

Graphics File: prettyplot.ps

[prettyplot results]

Data files

Prettyplot uses a comparison matrix file to calculate similarity to the consensus.

For protein sequences EBLOSUM62 is used for the substitution matrix. For nucleotide sequence, EDNAFULL is used.

EMBOSS data files are distributed with the application and stored in the standard EMBOSS data directory, which is defined by the EMBOSS environment variable EMBOSS_DATA.

To see the available EMBOSS data files, run: 

% embossdata -showall

To fetch one of the data files (for example 'Exxx.dat') into your current directory for you to inspect or modify, run: 


% embossdata -fetch -file Exxx.dat

Users can provide their own data files in their own directories. Project specific files can be put in the current directory, or for tidier directory listings in a subdirectory called ".embossdata". Files for all EMBOSS runs can be put in the user's home directory, or again in a subdirectory called ".embossdata".

The directories are searched in the following order:

  • . (your current directory)
  • .embossdata (under your current directory)
  • ~/ (your home directory)
  • ~/.embossdata

Notes

A consesnsus sequence is calculated for the alignment and individual sequences compared to the consensus using the specified comparison matrix file. The default matrix for protein sequences is EBLOSUM62 and for nucleotide sequences is EDNAFULL. The drawing options render conserved sites and regions identified from the comparisons. For example, residues in a sequence are classed as "identical", "similar" or "other" to the consensus depending on user-specified thresholds of sequence similarity (-pair option). Residues in each class are rendered red, green and black by default (this can be changed).

There are other more general drawing options, for example, controlling the number of residues displayed per line, background shading and whether to display sequence names or not.

References

None.

Warnings

None.

Diagnostic Error Messages

None.

Exit status

It exits with status 0 unless an error is reported.

Known bugs

Portrait mode does not cover the whole page! This is a "feature" in plplot.

See also

Program name Description
abiview Display the trace in an ABI sequencer file
cirdna Draws circular maps of DNA constructs
edialign Local multiple alignment of sequences
emma Multiple sequence alignment (ClustalW wrapper)
iep Calculate the isoelectric point of proteins
infoalign Display basic information about a multiple sequence alignment
lindna Draws linear maps of DNA constructs
pepinfo Plot amino acid properties of a protein sequence in parallel
pepnet Draw a helical net for a protein sequence
pepwheel Draw a helical wheel diagram for a protein sequence
plotcon Plot conservation of a sequence alignment
plotorf Plot potential open reading frames in a nucleotide sequence
prettyseq Write a nucleotide sequence and its translation to file
remap Display restriction enzyme binding sites in a nucleotide sequence
showalign Display a multiple sequence alignment in pretty format
showfeat Display features of a sequence in pretty format
showpep Displays protein sequences with features in pretty format
sixpack Display a DNA sequence with 6-frame translation and ORFs
tranalign Generate an alignment of nucleic coding regions from aligned proteins

Author(s)

Ian Longden formerly at:
Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UK.

Please report all bugs to the EMBOSS bug team (emboss-bug © emboss.open-bio.org) not to the original author.

Many features were first implemented in the EGCG program "prettyplot" by Peter Rice
European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK

Please report all bugs to the EMBOSS bug team (emboss-bug © emboss.open-bio.org) not to the original author.

The original suggestions for the PrettyPlot program were from Denis Duboule and Sigfried Labeit at EMBL. Gert Vriend added the star marking. Rita Grandori suggested the -NOCOLLISION option.

History

Completed 5th May 1999.

Target users

This program is intended to be used by everyone and everything, from naive users to embedded scripts.

Comments

None